Recombinant Human Dihydroorotate dehydrogenase (quinone), mitochondrial (DHODH), partial

Product Description

Recombinant Human Dihydroorotate dehydrogenase (quinone), mitochondrial (DHODH), partial is available at Gentaur for Next week Delivery.

Gene Name: DHODH

Alternative Names : Dihydroorotate oxidase

Expression Region : 31-395aa

AA Sequence : TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 43.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.

Function : Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.

Involvement in disease : Postaxial acrofacial dysostosis (POADS)

Subcellular location : Mitochondrion inner membrane, Single-pass membrane protein

Protein Families : Dihydroorotate dehydrogenase family, Type 2 subfamily

Tissue Specificity :

Paythway :

Uniprot ID : Q02127