Product Description
Recombinant Human DNA repair protein complementing XP-G cells (ERCC5), partial is available at Gentaur for Next week Delivery.
Gene Name: ERCC5
Alternative Names : DNA excision repair protein ERCC-5 Xeroderma pigmentosum group G-complementing protein
Expression Region : 947-1186aa
AA Sequence : SFLWGKPDLDKIREFCQRYFGWNRTKTDESLFPVLKQLDAQQTQLRIDSFFRLAQQEKEDAKRIKSQRLNRAVTCMLRKEKEAAASEIEAVSVAMEKEFELLDKAKGKTQKRGITNTLEESSSLKRKRLSDSKGKNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVKNGGATTSSSSDSDDDGGKEKMVLVTARSVFGKKRRKLRRARGRKRKT
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 30.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Epigenetics and Nuclear Signaling
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Single-stranded structure-specific DNA endonuclease involved in DNA excision repair. Makes the 3'incision in DNA nucleotide excision repair (NER). Acts as a cofactor for a DNA glycosylase that removes oxidized pyrimidines from DNA. May also be involved in transcription-coupled repair of this kind of damage, in transcription by RNA polymerase II, and perhaps in other processes too.
Function : Single-stranded structure-specific DNA endonuclease involved in DNA excision repair. Makes the 3'incision in DNA nucleotide excision repair (NER). Acts as a cofactor for a DNA glycosylase that removes oxidized pyrimidines from DNA. May also be involved in transcription-coupled repair of this kind of damage, in transcription by RNA polymerase II, and perhaps in other processes too.
Involvement in disease : Xeroderma pigmentosum complementation group G (XP-G); Cerebro-oculo-facio-skeletal syndrome 3 (COFS3)
Subcellular location : Nucleus
Protein Families : XPG/RAD2 endonuclease family, XPG subfamily
Tissue Specificity :
Paythway : DNArepairpathway
Uniprot ID : P28715
Euro
British Pound
US Dollar