Recombinant Human DNA repair protein complementing XP-G cells (ERCC5), partial

Product Description

Recombinant Human DNA repair protein complementing XP-G cells (ERCC5), partial is available at Gentaur for Next week Delivery.

Gene Name: ERCC5

Alternative Names : DNA excision repair protein ERCC-5 Xeroderma pigmentosum group G-complementing protein

Expression Region : 947-1186aa

AA Sequence : SFLWGKPDLDKIREFCQRYFGWNRTKTDESLFPVLKQLDAQQTQLRIDSFFRLAQQEKEDAKRIKSQRLNRAVTCMLRKEKEAAASEIEAVSVAMEKEFELLDKAKGKTQKRGITNTLEESSSLKRKRLSDSKGKNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVKNGGATTSSSSDSDDDGGKEKMVLVTARSVFGKKRRKLRRARGRKRKT

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 30.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Single-stranded structure-specific DNA endonuclease involved in DNA excision repair. Makes the 3'incision in DNA nucleotide excision repair (NER). Acts as a cofactor for a DNA glycosylase that removes oxidized pyrimidines from DNA. May also be involved in transcription-coupled repair of this kind of damage, in transcription by RNA polymerase II, and perhaps in other processes too.

Function : Single-stranded structure-specific DNA endonuclease involved in DNA excision repair. Makes the 3'incision in DNA nucleotide excision repair (NER). Acts as a cofactor for a DNA glycosylase that removes oxidized pyrimidines from DNA. May also be involved in transcription-coupled repair of this kind of damage, in transcription by RNA polymerase II, and perhaps in other processes too.

Involvement in disease : Xeroderma pigmentosum complementation group G (XP-G); Cerebro-oculo-facio-skeletal syndrome 3 (COFS3)

Subcellular location : Nucleus

Protein Families : XPG/RAD2 endonuclease family, XPG subfamily

Tissue Specificity :

Paythway : DNArepairpathway

Uniprot ID : P28715