Recombinant Human Dual specificity protein phosphatase 22 (DUSP22)

Product Description

Recombinant Human Dual specificity protein phosphatase 22 (DUSP22) is available at Gentaur for Next week Delivery.

Gene Name: DUSP22

Alternative Names : JNK-stimulatory phosphatase-1

Expression Region : 1-184aa

AA Sequence : GNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 47.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Activates the Jnk signaling pathway. Dephosphorylates and deactivates p38 and stress-activated protein kinase/c-Jun N-terminal kinase (SAPK/JNK)

Function : Activates the Jnk signaling pathway. Dephosphorylates and deactivates p38 and stress-activated protein kinase/c-Jun N-terminal kinase (SAPK/JNK) (By similarity).

Involvement in disease :

Subcellular location : Cytoplasm, Nucleus

Protein Families : Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily

Tissue Specificity : Ubiquitous. Highest expression seen in heart, placenta, lung, liver, kidney and pancreas.

Paythway :

Uniprot ID : Q9NRW4