Product Description
Recombinant Human Dynactin subunit 3 (DCTN3) is available at Gentaur for Next week Delivery.
Gene Name: DCTN3
Alternative Names : Dynactin complex subunit 22KDA subunit;p22
Expression Region : 2-176aa
AA Sequence : AGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQAPWGVGVRDEAGSLVEDVGFAQFLSVLHFGPTGPVCGNH
Sequence Info : Full Length of Isoform 2
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 35.3 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cell Cycle
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Together with dynein may be involved in spindle assbly and cytokinesis.
Function : Together with dynein may be involved in spindle assembly and cytokinesis.
Involvement in disease :
Subcellular location : Cytoplasm, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Chromosome, centromere, kinetochore, Cytoplasm, cytoskeleton, spindle, Cleavage furrow, Midbody
Protein Families : Dynactin subunit 3 family
Tissue Specificity : Ubiquitously expressed. Highly expressed in muscle and pancreas and detected at lower levels in brain.
Paythway :
Uniprot ID : O75935
Euro
British Pound
US Dollar