Recombinant Human Dynactin subunit 3 (DCTN3)

Product Description

Recombinant Human Dynactin subunit 3 (DCTN3) is available at Gentaur for Next week Delivery.

Gene Name: DCTN3

Alternative Names : Dynactin complex subunit 22KDA subunit;p22

Expression Region : 2-176aa

AA Sequence : AGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQAPWGVGVRDEAGSLVEDVGFAQFLSVLHFGPTGPVCGNH

Sequence Info : Full Length of Isoform 2

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 35.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Cycle

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Together with dynein may be involved in spindle assbly and cytokinesis.

Function : Together with dynein may be involved in spindle assembly and cytokinesis.

Involvement in disease :

Subcellular location : Cytoplasm, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Chromosome, centromere, kinetochore, Cytoplasm, cytoskeleton, spindle, Cleavage furrow, Midbody

Protein Families : Dynactin subunit 3 family

Tissue Specificity : Ubiquitously expressed. Highly expressed in muscle and pancreas and detected at lower levels in brain.

Paythway :

Uniprot ID : O75935