Product Description
Recombinant Human Dynamin-1 (DNM1), partial is available at Gentaur for Next week Delivery.
Gene Name: DNM1
Alternative Names :
Expression Region : 2-245aa
AA Sequence : GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGK
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 32.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Neuroscience
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Microtubule-associated force-producing protein involved in producing microtubule bundles and able to bind and hydrolyze GTP. Most probably involved in vesicular trafficking processes. Involved in receptor-mediated endocytosis.
Function : Microtubule-associated force-producing protein involved in producing microtubule bundles and able to bind and hydrolyze GTP. Most probably involved in vesicular trafficking processes. Involved in receptor-mediated endocytosis.
Involvement in disease : Epileptic encephalopathy, early infantile, 31 (EIEE31)
Subcellular location : Cytoplasm, Cytoplasm, cytoskeleton
Protein Families : TRAFAC class dynamin-like GTPase superfamily, Dynamin/Fzo/YdjA family
Tissue Specificity :
Paythway : OxidativePhosphorylation
Uniprot ID : Q05193
Euro
British Pound
US Dollar