Recombinant Human Dynamin-1 (DNM1), partial

Product Description

Recombinant Human Dynamin-1 (DNM1), partial is available at Gentaur for Next week Delivery.

Gene Name: DNM1

Alternative Names :

Expression Region : 2-245aa

AA Sequence : GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGK

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 32.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Microtubule-associated force-producing protein involved in producing microtubule bundles and able to bind and hydrolyze GTP. Most probably involved in vesicular trafficking processes. Involved in receptor-mediated endocytosis.

Function : Microtubule-associated force-producing protein involved in producing microtubule bundles and able to bind and hydrolyze GTP. Most probably involved in vesicular trafficking processes. Involved in receptor-mediated endocytosis.

Involvement in disease : Epileptic encephalopathy, early infantile, 31 (EIEE31)

Subcellular location : Cytoplasm, Cytoplasm, cytoskeleton

Protein Families : TRAFAC class dynamin-like GTPase superfamily, Dynamin/Fzo/YdjA family

Tissue Specificity :

Paythway : OxidativePhosphorylation

Uniprot ID : Q05193