Recombinant Human Dynein light chain 1, Cytoplasmic domain (DYNLL1)

Product Description

Recombinant Human Dynein light chain 1, Cytoplasmic domain (DYNLL1) is available at Gentaur for Next week Delivery.

Gene Name: DYNLL1

Alternative Names : 8KDA dynein light chain;DLC8Dynein light chain LC8-type 1;Protein inhibitor of neuronal nitric oxide synthase;PIN

Expression Region : 1-89aa

AA Sequence : MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 37.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Apoptosis

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Acts as one of several non-catalytic accessory components of the Cytoplasmic domain dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic domain dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures.Binds and inhibits the catalytic activity of neuronal nitric oxide synthase.Promotes transactivation functions of ESR1 and plays a role in the nuclear localization of ESR1.Regulates apoptotic activities of BCL2L11 by sequestering it to microtubules. Upon apoptotic stimuli the BCL2L11-DYNLL1 complex dissociates from Cytoplasmic domain dynein and translocates to mitochondria and sequesters BCL2 thus neutralizing its antiapoptotic activity.

Function : Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures.; FUNCTION

Involvement in disease :

Subcellular location : Cytoplasm, cytoskeleton, Nucleus, Mitochondrion

Protein Families : Dynein light chain family

Tissue Specificity : Ubiquitous.

Paythway :

Uniprot ID : P63167