Recombinant Human Early growth response protein 1 (EGR1), partial

Product Description

Recombinant Human Early growth response protein 1 (EGR1), partial is available at Gentaur for Next week Delivery.

Gene Name: EGR1

Alternative Names : AT225 (Nerve growth factor-induced protein A) (NGFI-A) (Transcription factor ETR103) (Transcription factor Zif268) (Zinc finger protein 225) (Zinc finger protein Krox-24) (KROX24) (ZNF225)

Expression Region : 444-543aa

AA Sequence : SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC

Sequence Info : Partial

Tag Info : N-terminal 6xHis-B2M-tagged

Theoretical MW : 24.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transcription

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3'(EGR-site). Activates the transcription of target genes whose products are required for mitogenesis and differentiation.

Function : Transcriptional regulator

Involvement in disease :

Subcellular location : Nucleus, Cytoplasm

Protein Families : EGR C2H2-type zinc-finger protein family

Tissue Specificity : Detected in neutrophils (at protein level).

Paythway : AGE-RAGEsignalingpathwayindiabeticcomplications

Uniprot ID : P18146