Product Description
Recombinant Human Elongin-C (ELOC) is available at Gentaur for Next week Delivery.
Gene Name: ELOC
Alternative Names : Elongin 15KDA subunitElongin-C;EloCRNA polymerase II transcription factor SIII subunit CSIII p15
Expression Region : 1-112aa
AA Sequence : MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 39.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past tplate-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex).
Function : SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex)
Involvement in disease :
Subcellular location : Nucleus
Protein Families : SKP1 family
Tissue Specificity : Overexpressed in prostate cancer cell line PC-3 and breast cancer cell line SK-BR-3.
Paythway : HIF-1signalingpathway
Uniprot ID : Q15369
Euro
British Pound
US Dollar