Recombinant Human Elongin-C (ELOC)

Product Description

Recombinant Human Elongin-C (ELOC) is available at Gentaur for Next week Delivery.

Gene Name: ELOC

Alternative Names : Elongin 15KDA subunitElongin-C;EloCRNA polymerase II transcription factor SIII subunit CSIII p15

Expression Region : 1-112aa

AA Sequence : MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 39.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past tplate-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex).

Function : SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex)

Involvement in disease :

Subcellular location : Nucleus

Protein Families : SKP1 family

Tissue Specificity : Overexpressed in prostate cancer cell line PC-3 and breast cancer cell line SK-BR-3.

Paythway : HIF-1signalingpathway

Uniprot ID : Q15369