Recombinant Human EPO-alpha/Fc Chimera protein (EPOFc) (Active)

Product Description

Recombinant Human EPO-alpha/Fc Chimera protein (EPOFc) (Active) is available at Gentaur for Next week Delivery.

Gene Name: EPO

Alternative Names : Epoetin,

Expression Region : 28-193aa

AA Sequence : APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR+IEGRMDEPKSSDKTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPTPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Sequence Info : Full Length of Mature Protein

Tag Info : C-terminal FC-tagged

Theoretical MW : 45.3 kDa

Storage Buffer : Lyophilized from a 0.2?m filtered sodium citrate buffer (1 liter of ddH2O containing 5.9 g of sodium citrate, 5.8 g of sodium chloride and 0.06 g of citric acid)

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 determined by a cell proliferation assay using human megakaryoblastic leukemia cells is less than 2 ng/ml, corresponding to a specific activity of ? 5.0 × 105 IU/mg.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass.

Function : Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3.

Involvement in disease : Microvascular complications of diabetes 2 (MVCD2)

Subcellular location : Secreted

Protein Families : EPO/TPO family

Tissue Specificity : Produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals.

Paythway : HIF-1signalingpathway

Uniprot ID : P01588