Recombinant Human Eukaryotic translation elongation factor 1 epsilon-1 (EEF1E1)

Product Description

Recombinant Human Eukaryotic translation elongation factor 1 epsilon-1 (EEF1E1) is available at Gentaur for Next week Delivery.

Gene Name: EEF1E1

Alternative Names : Aminoacyl tRNA synthetase complex-interacting multifunctional protein 3;Elongation factor p18;Multisynthase complex auxiliary component p18

Expression Region : 2-174aa

AA Sequence : AAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 35.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Positive modulator of ATM response to DNA damage.

Function : Positive modulator of ATM response to DNA damage.

Involvement in disease :

Subcellular location : Cytoplasm, Cytoplasm, cytosol, Nucleus

Protein Families :

Tissue Specificity : Down-regulated in various cancer tissues.

Paythway :

Uniprot ID : O43324