Recombinant Human Fatty acid-binding protein, epidermal (FABP5)

Product Description

Recombinant Human Fatty acid-binding protein, epidermal (FABP5) is available at Gentaur for Next week Delivery.

Gene Name: FABP5

Alternative Names : Epidermal-type fatty acid-binding protein

Expression Region : 1-135aa

AA Sequence : MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 42.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cardiovascular

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : High specificity for fatty acids. Highest affinity for C18 chain length. Decreasing the chain length or introducing double bonds reduces the affinity. May be involved in keratinocyte differentiation.

Function : High specificity for fatty acids. Highest affinity for C18 chain length. Decreasing the chain length or introducing double bonds reduces the affinity. May be involved in keratinocyte differentiation.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Calycin superfamily, Fatty-acid binding protein (FABP) family

Tissue Specificity : Keratinocytes; highly expressed in psoriatic skin.

Paythway : PPARsignalingpathway

Uniprot ID : Q01469