Recombinant Human Fibroblast growth factor 14 (FGF14)

Product Description

Recombinant Human Fibroblast growth factor 14 (FGF14) is available at Gentaur for Next week Delivery.

Gene Name: FGF14

Alternative Names : Fibroblast growth factor homologous factor 4

Expression Region : 1-252aa

AA Sequence : MVKPVPLFRRTDFKLLLCNHKDLFFLRVSKLLDCFSPKSMWFLWNIFSKGTHMLQCLCGKSLKKNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTT

Sequence Info : Full Length of Isoform 2

Tag Info : N-terminal GST-tagged

Theoretical MW : 55.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Probably involved in nervous system development and function.

Function : Probably involved in nervous system development and function.

Involvement in disease : Spinocerebellar ataxia 27 (SCA27)

Subcellular location : Nucleus

Protein Families : Heparin-binding growth factors family

Tissue Specificity : Nervous system.

Paythway :

Uniprot ID : Q92915