Recombinant Human Fibroblast growth factor 7 (FGF7) (Active)

Product Description

Recombinant Human Fibroblast growth factor 7 (FGF7) (Active) is available at Gentaur for Next week Delivery.

Gene Name: FGF7

Alternative Names : Fibroblast growth factor 7;FGF-7;Heparin-binding growth factor 7;HBGF-7;Keratinocyte growth factor;FGF7;KGF

Expression Region : 32-194aa

AA Sequence : CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Sequence Info : Full Length of Mature Protein

Tag Info : Tag-Free

Theoretical MW : 19.1 kDa

Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 150 mM NaCl, pH 8.0

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined by its ability to bind Human FGFR3 in functional ELISA is less than 5 ug/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Fibroblast growth factor 7 (FGF7) is a secreted protein which is mainly located in epithelial cells and belongs to the heparin-binding growth factors family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF7 is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. It is possible major paracrine effector of normal epithelial cell proliferation.

Function : Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Heparin-binding growth factors family

Tissue Specificity : Epithelial cell.

Paythway : MAPKsignalingpathway

Uniprot ID : P21781