Product Description
Recombinant Human Fractalkine (CX3CL1), partial is available at Gentaur for Next week Delivery.
Gene Name: CX3CL1
Alternative Names : C-X3-C motif chemokine 1CX3C membrane-anchored chemokineNeurotactin;Small-inducible cytokine D1
Expression Region : 210-150aa
AA Sequence : QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG
Sequence Info : Partial
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 24.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cell Adhesion
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : The soluble form is chotactic for T-cells and monocytes, but not for neutrophils. The mbrane-bound form promotes adhesion of those leukocytes to endothelial cells. May play a role in regulating leukocyte adhesion and migration processes at the endothelium. Binds to CX3CR1.
Function : Acts as a ligand for both CX3CR1 and integrins. Binds to CX3CR1
Involvement in disease :
Subcellular location : Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Processed fractalkine: Secreted
Protein Families : Intercrine delta family
Tissue Specificity : Expressed in the seminal plasma, endometrial fluid and follicular fluid (at protein level). Small intestine, colon, testis, prostate, heart, brain, lung, skeletal muscle, kidney and pancreas. Most abundant in the brain and heart.
Paythway : Chemokinesignalingpathway
Uniprot ID : P78423
Euro
British Pound
US Dollar