Recombinant Human Fractalkine (CX3CL1), partial

Product Description

Recombinant Human Fractalkine (CX3CL1), partial is available at Gentaur for Next week Delivery.

Gene Name: CX3CL1

Alternative Names : C-X3-C motif chemokine 1CX3C membrane-anchored chemokineNeurotactin;Small-inducible cytokine D1

Expression Region : 210-150aa

AA Sequence : QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 24.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Adhesion

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : The soluble form is chotactic for T-cells and monocytes, but not for neutrophils. The mbrane-bound form promotes adhesion of those leukocytes to endothelial cells. May play a role in regulating leukocyte adhesion and migration processes at the endothelium. Binds to CX3CR1.

Function : Acts as a ligand for both CX3CR1 and integrins. Binds to CX3CR1

Involvement in disease :

Subcellular location : Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Processed fractalkine: Secreted

Protein Families : Intercrine delta family

Tissue Specificity : Expressed in the seminal plasma, endometrial fluid and follicular fluid (at protein level). Small intestine, colon, testis, prostate, heart, brain, lung, skeletal muscle, kidney and pancreas. Most abundant in the brain and heart.

Paythway : Chemokinesignalingpathway

Uniprot ID : P78423