Recombinant Human Glucagon (GCG), partial

Product Description

Recombinant Human Glucagon (GCG), partial is available at Gentaur for Next week Delivery.

Gene Name: GCG

Alternative Names : Incretin hormoneGlucagon-like peptide 1(7-37);GLP-1(7-37)Glucagon-like peptide 1(7-36);GLP-1(7-36)Glucagon-like peptide 2;GLP-2

Expression Region : 53-89aa

AA Sequence : HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 6.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycia. Plays an important role in initiating and maintaining hyperglycic conditions in diabetes.GLP-1 is a potent stimulator of glucose-dependent insulin release. Play important roles on gastric motility and the suppression of plasma glucagon levels. May be involved in the suppression of satiety and stimulation of glucose disposal in peripheral tissues, independent of the actions of insulin. Have growth-promoting activities on intestinal epithelium. May also regulate the hypothalamic pituitary axis (HPA) via effects on LH, TSH, CRH, oxytocin, and vasopressin secretion. Increases islet mass through stimulation of islet neogenesis and pancreatic beta cell proliferation. Inhibits beta cell apoptosis.GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability.Oxyntomodulin significantly reduces food intake. Inhibits gastric ptying in humans. Suppression of gastric ptying may lead to increased gastric distension, which may contribute to satiety by causing a sensation of fullness.Glicentin may modulate gastric acid secretion and the gastro-pyloro-duodenal activity. May play an important role in intestinal mucosal growth in the early period of life.

Function : Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes.; FUNCTION

Involvement in disease :

Subcellular location : Secreted

Protein Families : Glucagon family

Tissue Specificity : Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP-1 and GLP-2 are also secreted in selected neurons in the brain.

Paythway : Glucagonsignalingpathway

Uniprot ID : P01275