Recombinant Human Glutamate receptor ionotropic, NMDA 2A (GRIN2A), partial

Product Description

Recombinant Human Glutamate receptor ionotropic, NMDA 2A (GRIN2A), partial is available at Gentaur for Next week Delivery.

Gene Name: GRIN2A

Alternative Names : Glutamate [NMDA] receptor subunit epsilon-1N-methyl D-aspartate receptor subtype 2A;NMDAR2A;NR2A;hNR2A

Expression Region : 23-555aa

AA Sequence : VYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTI

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 18.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transport

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : NMDA receptor subtype of glutamate-gated ion channels possesses high calcium permeability and voltage-dependent sensitivity to magnesium. Activation requires binding of agonist to both types of subunits.

Function : Component of NMDA receptor complexes that function as heterotetrameric, ligand-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Channel activation requires binding of the neurotransmitter glutamate to the epsilon subunit, glycine binding to the zeta subunit, plus membrane depolarization to eliminate channel inhibition by Mg(2+)

Involvement in disease : Epilepsy, focal, with speech disorder and with or without mental retardation (FESD)

Subcellular location : Cell membrane, Multi-pass membrane protein, Cell junction, synapse, postsynaptic cell membrane, Multi-pass membrane protein

Protein Families : Glutamate-gated ion channel (TC 1.A.10.1) family, NR2A/GRIN2A subfamily

Tissue Specificity :

Paythway : Calciumsignalingpathway

Uniprot ID : Q12879