Recombinant Human Glutamyl-tRNA (Gln) amidotransferase subunit C, mitochondrial (GATC)

Product Description

Recombinant Human Glutamyl-tRNA (Gln) amidotransferase subunit C, mitochondrial (GATC) is available at Gentaur for Next week Delivery.

Gene Name: GATC

Alternative Names : Protein 15E1.2

Expression Region : 1-136aa

AA Sequence : MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 42.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).

Function : Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).

Involvement in disease :

Subcellular location : Mitochondrion

Protein Families : GatC family

Tissue Specificity :

Paythway :

Uniprot ID : O43716