Product Description
Recombinant Human Glutaredoxin-1 (GLRX) is available at Gentaur for Next week Delivery.
Gene Name: GLRX
Alternative Names : Thioltransferase-1;TTase-1
Expression Region : 1-106aa
AA Sequence : MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 38.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Transport
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins.
Function : Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins.
Involvement in disease :
Subcellular location : Cytoplasm
Protein Families : Glutaredoxin family
Tissue Specificity :
Paythway :
Uniprot ID : P35754
Euro
British Pound
US Dollar