Recombinant Human Glutaredoxin-1 (GLRX)

Product Description

Recombinant Human Glutaredoxin-1 (GLRX) is available at Gentaur for Next week Delivery.

Gene Name: GLRX

Alternative Names : Thioltransferase-1;TTase-1

Expression Region : 1-106aa

AA Sequence : MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 38.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transport

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins.

Function : Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Glutaredoxin family

Tissue Specificity :

Paythway :

Uniprot ID : P35754