Product Description
Recombinant Human Golgi SNAP receptor complex member 2 (GOSR2), partial is available at Gentaur for Next week Delivery.
Gene Name: GOSR2
Alternative Names : 27KDA Golgi SNARE protein;Membrin
Expression Region : 1-190aa
AA Sequence : MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDK
Sequence Info : Cytoplasmic Domain
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 38.3 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Involved in transport of proteins from the cis/medial-Golgi to the trans-Golgi network.
Function : Involved in transport of proteins from the cis/medial-Golgi to the trans-Golgi network.
Involvement in disease : Epilepsy, progressive myoclonic 6 (EPM6)
Subcellular location : Golgi apparatus, cis-Golgi network membrane, Single-pass type IV membrane protein, Golgi apparatus membrane, Endoplasmic reticulum membrane
Protein Families : GOSR2 family
Tissue Specificity :
Paythway :
Uniprot ID : O14653
 Euro
 Euro
             British Pound
 British Pound
             US Dollar
 US Dollar
             
             
                 
       
           
           
           
           
          