Recombinant Human Golgi SNAP receptor complex member 2 (GOSR2), partial

Product Description

Recombinant Human Golgi SNAP receptor complex member 2 (GOSR2), partial is available at Gentaur for Next week Delivery.

Gene Name: GOSR2

Alternative Names : 27KDA Golgi SNARE protein;Membrin

Expression Region : 1-190aa

AA Sequence : MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDK

Sequence Info : Cytoplasmic Domain

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 38.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in transport of proteins from the cis/medial-Golgi to the trans-Golgi network.

Function : Involved in transport of proteins from the cis/medial-Golgi to the trans-Golgi network.

Involvement in disease : Epilepsy, progressive myoclonic 6 (EPM6)

Subcellular location : Golgi apparatus, cis-Golgi network membrane, Single-pass type IV membrane protein, Golgi apparatus membrane, Endoplasmic reticulum membrane

Protein Families : GOSR2 family

Tissue Specificity :

Paythway :

Uniprot ID : O14653