Product Description
Recombinant Human Granulocyte colony-stimulating factor (CSF3), partial is available at Gentaur for Next week Delivery.
Gene Name: CSF3
Alternative Names : Colony-stimulating factor;CSFMolgramostin;Sargramostim
Expression Region : 27-200aa
AA Sequence : VQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRV
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 22.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Cytokine that stimulates the growth and differentiation of hatopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.
Function : Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes.
Involvement in disease :
Subcellular location : Secreted
Protein Families : IL-6 superfamily
Tissue Specificity :
Paythway : Jak-STATsignalingpathway
Uniprot ID : P09919
Euro
British Pound
US Dollar