Recombinant Human Granulocyte colony-stimulating factor (CSF3), partial

Product Description

Recombinant Human Granulocyte colony-stimulating factor (CSF3), partial is available at Gentaur for Next week Delivery.

Gene Name: CSF3

Alternative Names : Colony-stimulating factor;CSFMolgramostin;Sargramostim

Expression Region : 27-200aa

AA Sequence : VQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRV

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 22.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Cytokine that stimulates the growth and differentiation of hatopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.

Function : Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes.

Involvement in disease :

Subcellular location : Secreted

Protein Families : IL-6 superfamily

Tissue Specificity :

Paythway : Jak-STATsignalingpathway

Uniprot ID : P09919