Recombinant Human Group XIIA secretory phospholipase A2 (PLA2G12A), partial

Product Description

Recombinant Human Group XIIA secretory phospholipase A2 (PLA2G12A), partial is available at Gentaur for Next week Delivery.

Gene Name: PLA2G12A

Alternative Names : Phosphatidylcholine 2-acylhydrolase 12A

Expression Region : 23-185aa

AA Sequence : QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEE

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 20.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine.

Function : PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine.

Involvement in disease :

Subcellular location : Secreted, Cytoplasm

Protein Families : Phospholipase A2 family

Tissue Specificity : Abundantly expressed in heart, skeletal muscle, kidney, liver and pancreas.

Paythway : Vascularsmoothmusclecontraction

Uniprot ID : Q9BZM1