Product Description
Recombinant Human Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G) is available at Gentaur for Next week Delivery.
Gene Name: GADD45G
Alternative Names : Cytokine-responsive protein CR6DNA damage-inducible transcript 2 protein;DDIT-2
Expression Region : 1-159aa
AA Sequence : MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 33.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Epigenetics and Nuclear Signaling
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK.
Function : Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK.
Involvement in disease :
Subcellular location :
Protein Families : GADD45 family
Tissue Specificity :
Paythway : MAPKsignalingpathway
Uniprot ID : O95257
 Euro
            
 British Pound
            
 US Dollar