Recombinant Human Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G)

Product Description

Recombinant Human Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G) is available at Gentaur for Next week Delivery.

Gene Name: GADD45G

Alternative Names : Cytokine-responsive protein CR6DNA damage-inducible transcript 2 protein;DDIT-2

Expression Region : 1-159aa

AA Sequence : MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 33.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK.

Function : Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK.

Involvement in disease :

Subcellular location :

Protein Families : GADD45 family

Tissue Specificity :

Paythway : MAPKsignalingpathway

Uniprot ID : O95257