Recombinant Human Growth/differentiation factor 2 (GDF2)

Product Description

Recombinant Human Growth/differentiation factor 2 (GDF2) is available at Gentaur for Next week Delivery.

Gene Name: GDF2

Alternative Names : Bone morphogenetic protein 9 Short name: BMP-9

Expression Region : 300-429aa

AA Sequence : HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 16.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Potent circulating inhibitor of angiogenesis. Could be involved in bone formation. Signals through the type I activin receptor ACVRL1 but not other Alks. Signaling through SMAD1 in endothelial cells requires TGF-beta coreceptor endoglin/ENG.

Function : Potent circulating inhibitor of angiogenesis. Signals through the type I activin receptor ACVRL1 but not other Alks. Signaling through SMAD1 in endothelial cells requires TGF-beta coreceptor endoglin/ENG.

Involvement in disease : Telangiectasia, hereditary hemorrhagic, 5 (HHT5)

Subcellular location : Secreted

Protein Families : TGF-beta family

Tissue Specificity : Detected in blood plasma (at protein level).

Paythway :

Uniprot ID : Q9UK05