Euro
British Pound
US Dollar
Product Description
Recombinant Human Growth/differentiation factor 8 (MSTN) is available at Gentaur for Next week Delivery.
Gene Name: MSTN
Alternative Names : Myostatin
Expression Region : 267-375aa
AA Sequence : DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 16.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Acts specifically as a negative regulator of skeletal muscle growth.
Function : Acts specifically as a negative regulator of skeletal muscle growth.
Involvement in disease : Muscle hypertrophy (MSLHP)
Subcellular location : Secreted
Protein Families : TGF-beta family
Tissue Specificity :
Paythway :
Uniprot ID : O14793
