Recombinant Human GrpE protein homolog 1, mitochondrial (GRPEL1)

Product Description

Recombinant Human GrpE protein homolog 1, mitochondrial (GRPEL1) is available at Gentaur for Next week Delivery.

Gene Name: GRPEL1

Alternative Names : HMGE Mt-GrpE#1

Expression Region : 1-217aa

AA Sequence : CTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 48.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins.

Function : Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner (By similarity). Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins

Involvement in disease :

Subcellular location : Mitochondrion matrix

Protein Families : GrpE family

Tissue Specificity :

Paythway :

Uniprot ID : Q9HAV7