Recombinant Human Heat shock factor-binding protein 1 (HSBP1), partial

Product Description

Recombinant Human Heat shock factor-binding protein 1 (HSBP1), partial is available at Gentaur for Next week Delivery.

Gene Name: HSBP1

Alternative Names : Nasopharyngeal carcinoma-associated antigen 13;NPC-A-13

Expression Region : 1-75aa

AA Sequence : MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKIPATQK

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 35.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Negative regulator of the heat shock response. Negatively affects HSF1 DNA-binding activity. May have a role in the suppression of the activation of the stress response during the aging process.

Function : Negative regulator of the heat shock response. Negatively affects HSF1 DNA-binding activity. May have a role in the suppression of the activation of the stress response during the aging process.

Involvement in disease :

Subcellular location : Nucleus

Protein Families : HSBP1 family

Tissue Specificity :

Paythway :

Uniprot ID : O75506