Recombinant Human Hemoglobin subunit gamma-1 (HBG1)

Product Description

Recombinant Human Hemoglobin subunit gamma-1 (HBG1) is available at Gentaur for Next week Delivery.

Gene Name: HBG1

Alternative Names : Gamma-1-globin (Hb F Agamma) (Hemoglobin gamma-1 chain) (Hemoglobin gamma-A chain)

Expression Region : 2-147aa

AA Sequence : GHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVASALSSRYH

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 23.0 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Gamma chains make up the fetal hemoglobin F, in combination with alpha chains.

Function : Gamma chains make up the fetal hemoglobin F, in combination with alpha chains.

Involvement in disease :

Subcellular location :

Protein Families : Globin family

Tissue Specificity : Red blood cells.

Paythway :

Uniprot ID : P69891