Recombinant Human herpesvirus 6A DNA polymerase processivity factor (U27)

Product Description

Recombinant Human herpesvirus 6A DNA polymerase processivity factor (U27) is available at Gentaur for Next week Delivery.

Gene Name: U27

Alternative Names : Phosphoprotein P41;PP41;Polymerase accessory protein;PAP

Expression Region : 1-393aa

AA Sequence : MCWSFHLFFKAHKARVGARTSFLTEMERGSRDHHRDHRDHREHRETREPPTLAFHMKSWKTINKSLKAFAKLLKENTTVTFTPQPSIIIQSAKNHLVQKLTIQAECLFLSDTDRFLTKTINNHIPLFESFMNIISNPEVTKMYIQHDSDLYTRVLVTASDTCTQASVPCVHGQEVVRDTGRSPLRIDLDHSTVSDVLKWLSPVTKTKRSGKSDALMAHIIVQVNPPTIKFVTEMNELEFSNSNKVIFYDVKNMRFNLSAKNLQQALSMCAVIKTSCSLRTVAAKDCKLILTSKSTLLTVEAFLTQEQLKEESRFERMGKQDDGKGDRSHKNDDGSALASKQEMQYKITNYMVPAKNGTAGSSLFNEKEDSESDDSMHFDYSSNPNPKRQRCVV

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 46.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Accessory subunit of the DNA polymerase that acts to increase the processivity of polymerization.

Function : Accessory subunit of the DNA polymerase that acts to increase the processivity of polymerization.

Involvement in disease :

Subcellular location :

Protein Families : Herpesviridae polymerase accessory protein family

Tissue Specificity :

Paythway :

Uniprot ID : P52439