Recombinant Human Histamine H1 receptor (HRH1), partial

Product Description

Recombinant Human Histamine H1 receptor (HRH1), partial is available at Gentaur for Next week Delivery.

Gene Name: HRH1

Alternative Names : Short name:H1R Short name:HH1R

Expression Region : 211-416aa

AA Sequence : AKIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQ

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 27.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : In peripheral tissues, the H1 subclass of histamine receptors mediates the contraction of smooth muscles, increase in capillary permeability due to contraction of terminal venules, and catecholamine release from adrenal medulla, as well as mediating neurotransmission in the central nervous system.

Function : In peripheral tissues, the H1 subclass of histamine receptors mediates the contraction of smooth muscles, increase in capillary permeability due to contraction of terminal venules, and catecholamine release from adrenal medulla, as well as mediating neurotransmission in the central nervous system.

Involvement in disease :

Subcellular location : Cell membrane, Multi-pass membrane protein

Protein Families : G-protein coupled receptor 1 family

Tissue Specificity :

Paythway : Calciumsignalingpathway

Uniprot ID : P35367