Recombinant Human HLA class I histocompatibility antigen, alpha chain E (HLA-E), partial

Product Description

Recombinant Human HLA class I histocompatibility antigen, alpha chain E (HLA-E), partial is available at Gentaur for Next week Delivery.

Gene Name: HLA-E

Alternative Names : MHC class I antigen E (HLA-6.2) (HLAE)

Expression Region : 22-305aa

AA Sequence : GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPI

Sequence Info : Extracellular Domain

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 36.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Preferably binds to a peptide derived from the signal sequence of most HLA-A, -B, -C and -G molecules.

Function : Preferably binds to a peptide derived from the signal sequence of most HLA-A, -B, -C and -G molecules.

Involvement in disease :

Subcellular location : Membrane, Single-pass type I membrane protein

Protein Families : MHC class I family

Tissue Specificity :

Paythway : Cellularsenescence

Uniprot ID : P13747