Product Description
Recombinant Human HLA class II histocompatibility antigen, DM beta chain (HLA-DMB), partial is available at Gentaur for Next week Delivery.
Gene Name: HLA-DMB
Alternative Names : MHC class II antigen DMB Really interesting new gene 7 protein DMB, RING7
Expression Region : 19-218aa
AA Sequence : GGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLK
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 26.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Plays a critical role in catalyzing the release of class II-associated invariant chain peptide (CLIP) from newly synthesized MHC class II molecules and freeing the peptide binding site for acquisition of antigenic peptides. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO.
Function : Plays a critical role in catalyzing the release of class II-associated invariant chain peptide (CLIP) from newly synthesized MHC class II molecules and freeing the peptide binding site for acquisition of antigenic peptides. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO.
Involvement in disease :
Subcellular location : Late endosome membrane, Single-pass type I membrane protein, Lysosome membrane, Single-pass type I membrane protein
Protein Families : MHC class II family
Tissue Specificity :
Paythway : Antigenprocessingandpresentation
Uniprot ID : P28068
Euro
British Pound
US Dollar