Recombinant Human HLA class II histocompatibility antigen, DM beta chain (HLA-DMB), partial

Product Description

Recombinant Human HLA class II histocompatibility antigen, DM beta chain (HLA-DMB), partial is available at Gentaur for Next week Delivery.

Gene Name: HLA-DMB

Alternative Names : MHC class II antigen DMB Really interesting new gene 7 protein DMB, RING7

Expression Region : 19-218aa

AA Sequence : GGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLK

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 26.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Plays a critical role in catalyzing the release of class II-associated invariant chain peptide (CLIP) from newly synthesized MHC class II molecules and freeing the peptide binding site for acquisition of antigenic peptides. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO.

Function : Plays a critical role in catalyzing the release of class II-associated invariant chain peptide (CLIP) from newly synthesized MHC class II molecules and freeing the peptide binding site for acquisition of antigenic peptides. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO.

Involvement in disease :

Subcellular location : Late endosome membrane, Single-pass type I membrane protein, Lysosome membrane, Single-pass type I membrane protein

Protein Families : MHC class II family

Tissue Specificity :

Paythway : Antigenprocessingandpresentation

Uniprot ID : P28068