Recombinant Human Immunoglobulin-like domain-containing receptor 2 (ILDR2), partial

Product Description

Recombinant Human Immunoglobulin-like domain-containing receptor 2 (ILDR2), partial is available at Gentaur for Next week Delivery.

Gene Name: ILDR2

Alternative Names :

Expression Region : 1-186aa

AA Sequence : MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDSGLYYCIITTPDDLEGKNEDSVELLVLGRTGLLADLLPSFAVEIMPE

Sequence Info : Extracellular Domain

Tag Info : N-terminal GST-tagged

Theoretical MW : 48.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May be involved in lipid homeostasis and ER stress pathways.

Function : May be involved in lipid homeostasis and ER stress pathways.

Involvement in disease :

Subcellular location : Endoplasmic reticulum membrane, Single-pass type I membrane protein

Protein Families : Immunoglobulin superfamily, LISCH7 family

Tissue Specificity :

Paythway :

Uniprot ID : Q71H61