Euro
British Pound
US Dollar
Product Description
Recombinant Human Insulin growth factor-like family member 1 (IGFL1) is available at Gentaur for Next week Delivery.
Gene Name: IGFL1
Alternative Names :
Expression Region : 25-110aa
AA Sequence : APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW : 16.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Probable ligand of the IGFLR1 cell membrane receptor.
Function : Probable ligand of the IGFLR1 cell membrane receptor.
Involvement in disease :
Subcellular location : Secreted
Protein Families : IGFL family
Tissue Specificity : Detected in ovary and spinal cord.
Paythway :
Uniprot ID : Q6UW32
