Recombinant Human Insulin-like growth factor II (IGF2) (Active)

Product Description

Recombinant Human Insulin-like growth factor II (IGF2) (Active) is available at Gentaur for Next week Delivery.

Gene Name: IGF2

Alternative Names : Insulin-Like Growth Factor II; IGF-II; Somatomedin-A; IGF2; PP1446

Expression Region : 25-91aa

AA Sequence : AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE

Sequence Info : Full Length of Mature Protein

Tag Info : Tag-Free

Theoretical MW : 8.91 kDa

Storage Buffer : Lyophilized from a 0.2 ?m Filtered 5 mM HAC, PH 3.0

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined in a serum-free cell proliferation assay using MCF?7 human breast cancer cells is less than 20 ng/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Insulin-Like Growth Factor II (IGF2) belongs to the insulin family of polypeptide growth factors that is involved in development and growth. Members of this family are structurally homologous to proinsulin, and share higher sequence identity. IGF2 is expressed only from the paternally inherited allele and believed to be secreted by the liver and to circulate in the blood. IGF2 possess growth-promoting activity and can stimulate the proliferation and survival of various cell types including muscle, bone, and cartilage tissue in vitro. IGF2 is influenced by placental lactogen and may play a role in fetal development.

Function : The insulin-like growth factors possess growth-promoting activity. Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF-II is influenced by placental lactogen. Also involved in tissue differentiation. Positively regulates myogenic transcription factor MYOD1 function by facilitating the recruitment of transcriptional coactivators, thereby controlling muscle terminal differentiation (By similarity). In adults, involved in glucose metabolism in adipose tissue, skeletal muscle and liver (Probable).

Involvement in disease : Silver-Russell syndrome (SRS); Growth restriction, severe, with distinctive facies (GRDF)

Subcellular location : Secreted

Protein Families : Insulin family

Tissue Specificity : Expressed in heart, placenta, lung, liver, muscle, kidney, tongue, limb, eye and pancreas.

Paythway : MAPKsignalingpathway

Uniprot ID : P01344