Euro
British Pound
US Dollar
Product Description
Recombinant Human Interferon alpha-2 (IFNA2) is available at Gentaur for Next week Delivery.
Gene Name: IFNA2
Alternative Names : Interferon alpha-A;LeIF A
Expression Region : 24-188aa
AA Sequence : CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 21.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cancer
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Produced by macrophages, IFN-alpha have antiviral activities.
Function : Produced by macrophages, IFN-alpha have antiviral activities.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Alpha/beta interferon family
Tissue Specificity :
Paythway : Jak-STATsignalingpathway
Uniprot ID : P01563
