Recombinant Human Interferon gamma (IFNG) (Active)

Product Description

Recombinant Human Interferon gamma (IFNG) (Active) is available at Gentaur for Next week Delivery.

Gene Name: IFNG

Alternative Names : Interferon Gamma; IFN-Gamma; Immune Interferon; IFNG

Expression Region : 24-166aa

AA Sequence : QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Sequence Info : Full Length of Mature Protein

Tag Info : Tag-Free

Theoretical MW : 16.8 kDa

Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 150 mM NaCl, pH 7.0

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : Specific activity as determined by a viral resistance assay using VSV-WISH cells is greater than 1.5 x 10^7 IU/mg.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : IFN? is the major interferon produced by mitogenically or antigenically stimulated lymphocytes. It is structurally different from type I interferon and its major activity is immunoregulation. It has been implicated in the expression of class II histocompatibility antigens in cells that do not normally produce them, leading to autoimmune disease. Interferon gamma is produced mainly byT-cells and natural killer cells activated by antigens, mitogens, or alloantigens. It is produced by lymphocytes expressing the surface antigens CD4 and CD8. IFN? synthesis is induced by IL-2, FGF-basic, and EGF.

Function : Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.

Involvement in disease : Aplastic anemia (AA)

Subcellular location : Secreted

Protein Families : Type II (or gamma) interferon family

Tissue Specificity : Released primarily from activated T lymphocytes.

Paythway : HIF-1signalingpathway

Uniprot ID : P01579