Recombinant Human Interferon lambda-3 (IFNL3) (Active)

Product Description

Recombinant Human Interferon lambda-3 (IFNL3) (Active) is available at Gentaur for Next week Delivery.

Gene Name: IFNL3

Alternative Names : Interleukin-28B; IL-28B; Cytokine Zcyto22; Interferon Lambda-3; IFN-Lambda-3; Interferon Lambda-4; IFN-Lambda-4; Interleukin-28C; IL-28C; IL28B; IFNL3; IFNL4; IL28C; ZCYTO22

Expression Region : 22-196aa

AA Sequence : VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

Sequence Info : Full Length of Mature Protein

Tag Info : C-terminal 6xHis-tagged

Theoretical MW : 20.67 kDa

Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 150 mM NaCl, 1 mM EDTA, pH 7.4

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined by its ability to binding IL10RB used funtional ELISA is less than 10 ug/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Interleukin-28B, also known as Cytokine Zcyto22, Interferon lambda-3, Interferon lambda-4, IFNL3, IFNL4, ZCYTO22 and IL28B, is a secreted cytokine which belongs to the IL-28/IL-29 family. IL-28 has also been shown to play a role in the adaptive immune response. IL28B has immunomodulatory activity and up-regulates MHC class I antigen expression. IL28B displays potent antiviral activity and antitumor activity. In addition, IL28B is a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. The ligand/receptor complex seems to signal through the Jak-STAT pathway.

Function : Cytokine with antiviral, antitumour and immunomodulatory activities. Plays a critical role in the antiviral host defense, predominantly in the epithelial tissues. Acts as a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1, and receptor engagement leads to the activation of the JAK/STAT signaling pathway resulting in the expression of IFN-stimulated genes (ISG), which mediate the antiviral state. Has a restricted receptor distribution and therefore restricted targets

Involvement in disease :

Subcellular location : Secreted

Protein Families : Lambda interferon family

Tissue Specificity :

Paythway : Jak-STATsignalingpathway

Uniprot ID : Q8IZI9