Recombinant Human Interleukin-12 (IL12) (Active)

Product Description

Recombinant Human Interleukin-12 (IL12) (Active) is available at Gentaur for Next week Delivery.

Gene Name: IL12

Alternative Names : Interleukin-12 subunit alpha;IL-12A;Cytotoxic lymphocyte maturation factor 35 kDa subunit;CLMF p35;IL-12 subunit p35;NK cell;IL12A;NKSF1 stimulatory factor chain 1;

Expression Region : 23-219aa & 23-328aa

AA Sequence : RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS & IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGD AGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Sequence Info : Heterodimer

Tag Info : Tag-Free

Theoretical MW : 22.5 & 34.7 kDa

Storage Buffer : Lyophilized from a 0.2 ?m filtered 1xPBS, pH 7.4

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined in a cell proliferation assay using antibody against CD3-activated human peripheral blood lymphocytes (PBL) is typically 0.5 ng/ml

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : IL-12 is a heterodimeric pleiotropic cytokine made up of a 40 kDa (p40) subunit and a 35 kDa (p35) subunit.Human and mouse IL?12 share 70% and 60% amino acid sequence identity in their p40 and p35 subunits, respectively. IL-12 is involved in the differentiation of naive T cells into Th1 cells. It is known as a T cell-stimulating factor, which can stimulate the growth and function of T cells. It stimulates the production of interferon-gamma (IFN-?) and tumor necrosis factor-alpha (TNF-?) from T cells and natural killer (NK) cells, and reduces IL-4 mediated suppression of IFN-?. T cells that produce IL-12 have a coreceptor, CD30, which is associated with IL-12 activity.IL-12 plays an important role in the activities of natural killer cells and T lymphocytes. IL-12 mediates enhancement of the cytotoxic activity of NK cells and CD8+ cytotoxic T lymphocytes.

Function :

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : P29459 & P29460