Recombinant Human Interleukin-12 subunit beta (IL12B)

Product Description

Recombinant Human Interleukin-12 subunit beta (IL12B) is available at Gentaur for Next week Delivery.

Gene Name: IL12B

Alternative Names : Cytotoxic lymphocyte maturation factor 40KDA subunit;CLMF p40IL-12 subunit p40NK cell stimulatory factor chain 2;NKSF2

Expression Region : 23-328aa

AA Sequence : IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal GST-tagged

Theoretical MW : 61.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.

Function : Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.

Involvement in disease : Immunodeficiency 29 (IMD29); Psoriasis 11 (PSORS11)

Subcellular location : Secreted

Protein Families : Type I cytokine receptor family, Type 3 subfamily

Tissue Specificity :

Paythway : Jak-STATsignalingpathway

Uniprot ID : P29460