Product Description
Recombinant Human Interleukin-13 (IL13), partial (Active) is available at Gentaur for Next week Delivery.
Gene Name: IL13
Alternative Names : Interleukin-13;IL-13;
Expression Region : 25-146aa
AA Sequence : LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
Sequence Info : Partial
Tag Info : C-terminal 6xHis-tagged
Theoretical MW : 14.3 kDa
Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 150 mM NaCl, pH 7.4
Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-
Biological Activity : The ED50 as determined in a cell proliferation assay using TF?1 human erythroleukemic cells is less than 5 ng/ml.
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Interleukin-13 is also known as IL-13. It is a protein that in humans is encoded by the IL13 gene. Interleukin-13 is an immunoregulatory cytokine produced primarily by activated Th2 cells.It is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils.
Function : Cytokine
Involvement in disease : Allergic rhinitis (ALRH)
Subcellular location : Secreted
Protein Families : IL-4/IL-13 family
Tissue Specificity :
Paythway : Jak-STATsignalingpathway
Uniprot ID : P35225
Euro
British Pound
US Dollar